PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12195.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 467aa    MW: 52009.3 Da    PI: 7.138
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12195.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.2e-16139184147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
       KHN12195.1 139 RGHWRPAEDSKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 184
                      899*****************************.***********996 PP

2Myb_DNA-binding55.41.4e-17191234146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l +a++ +G++ W+ Iar ++ gRt++ +k++w+ 
       KHN12195.1 191 RRAFSEEEEERLMQAHRIYGNK-WAMIARLFP-GRTDNAVKNHWHV 234
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.17134185IPR017930Myb domain
SMARTSM007172.9E-14138187IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-28139232IPR009057Homeodomain-like
PfamPF002491.0E-15139184IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-25140192IPR009057Homeodomain-like
CDDcd001673.86E-13142183No hitNo description
PROSITE profilePS5129426.929186240IPR017930Myb domain
SMARTSM007171.8E-14190238IPR001005SANT/Myb domain
PfamPF002492.8E-14191233IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-20193239IPR009057Homeodomain-like
CDDcd001671.16E-11193233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MASGKCCMIS PQQNQNAPTC YPSPMGMVYA DMMGSLSLAT VSNNASSSQE SNGYSYGYAS  60
GVENARSTRW SFPFTREFLS SNFEDCSDVV VGAGDSNNNI NEKTNHNNGK FSEEESNPNE  120
NNPAGGKEVD SGHSKLCARG HWRPAEDSKL KELVALYGPQ NWNLIAEKLE GRSGKSCRLR  180
WFNQLDPRIN RRAFSEEEEE RLMQAHRIYG NKWAMIARLF PGRTDNAVKN HWHVIMARKY  240
REQSSAYRRR RMSQPVYRRV DQNPTFVCSS RDNNASTTEP EPESSPSYYP NLNDRGVALT  300
NNIASFPSLH GVAAGAGGVV EFGSNVSPLN MTRGREAVSN TTHVGLCAQA QQQAPFDFFS  360
GGGSHDMVLE SMSQMRSRER TNESYNHHCQ LSGFYPHHPQ QYLMAMQQQL DNNNFYSFLN  420
SSSSASTTRT REPSSPCVAE IRDKVVNSDP PDGVPPPFFD FFGVGAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-341392397107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520083.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A0B2PSW80.0A0A0B2PSW8_GLYSO; Transcription factor MYB44
STRINGGLYMA02G12105.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-76myb domain protein 105
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]